Review



c2527h  (New England Biolabs)


Bioz Verified Symbol New England Biolabs is a verified supplier
Bioz Manufacturer Symbol New England Biolabs manufactures this product  
  • Logo
  • About
  • News
  • Press Release
  • Team
  • Advisors
  • Partners
  • Contact
  • Bioz Stars
  • Bioz vStars
    • 99
      Buy from Supplier

    Structured Review

    New England Biolabs c2527h
    C2527h, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 5095 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pmc13049519-2-9-5
    Average 99 stars, based on 5095 article reviews
    c2527h - by Bioz Stars, 2026-10
    99/100 stars

    Images

    Related Articles

    Virus:

    Article Title: Allele-specific zinc metalloprotease B influences cardiac damage during invasive pneumococcal disease.
    Article Snippet: .. REAGENT or RESOURCE SOURCE IDENTIFIER Antibodies Mouse Polyclonal αZmpA sera This study N/A Mouse Polyclonal αZmpB sera This study N/A Rabbit Polyclonal αZmpB sera This study N/A Mouse Polyclonal αZmpC sera This study N/A αCPS Serotype 4 (Rabbit) SSI Diagnostica Cat#: 16747 αRabbit IgG H&L (HRP)-conjugated secondary Abcam Cat#: ab6721; RRID: AB_95547 Goat anti-Rabbit IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 65-6111 Goat anti-Mouse IgG H&L (FITC)-conjugated secondary Invitrogen Cat#: 31541 Goat anti-Mouse IgG H&L (Alexa Fluor 568)- conjugated secondary Invitrogen Cat#: A-11004 Goat anti-Rabbit IgG H&L (Alexa Fluor 555)- conjugated secondary Abcam Cat#: ab150078; RRID: AB_2722519 Bacterial and virus strains S. pneumoniae strain TIGR4 Dr. Elaine Tuomanen; St. Jude Children’s Hospital, USA N/A S. pneumoniae strain TIGR4ΔzmpA This study N/A S. pneumoniae strain TIGR4ΔzmpB This study N/A S. pneumoniae strain TIGR4ΔzmpC This study N/A S. pneumoniae strain TIGR4Δ0663 This study N/A S. pneumoniae strain TIGR4 GPSC10 This study N/A S. pneumoniae strain TIGR4 GPSC12 This study N/A S. pneumoniae strain TIGR4 GPSC27 This study N/A S. pneumoniae strain TIGR4 GPSC10ΔFIVAR This study N/A S. pneumoniae strain TIGR4ΔzmpBΔply This study N/A S. pneumoniae strain 679647 Dr. David Litt; PHE, UK Clinical isolate of GPSC83 S. pneumoniae strain 471067 Dr. David Litt; PHE, UK Clinical isolate of GPSC10 S. pneumoniae strain UAB CI This study UAB clinical isolate of GPSC10 S. pneumoniae strain HUB09682 Dr. Carmen Ardanuy; Hospital Universitari de Bellvitge, Spain Clinical isolate of GPSC10 S. pneumoniae strain 517597 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain 703230 Dr. David Litt; PHE, UK Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_02 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC12 S. pneumoniae strain CUS_SPN_58 Dr. Luis Felipe Reyes; Universidad de la Sabana, Colombia Clinical isolate of GPSC9 E. coli strain BL21(DE3) NEB Cat#: C2527H (Continued on next page) Cell Reports ▪▪, 116574, ▪▪, 2025 17 OPEN ACCESS .. REAGENT or RESOURCE SOURCE IDENTIFIER Recombinant proteins, reagents, and chemicals rZmpA, expressed in E. coli SVHALENHLLLNYNTDYELTSGEKLPLPKEISG YTYIGYIKEGKTTSESEVSNQKSSVATPTKQQK VDYNVTPNFVDHPSTVQAIQEQTPVSSTKPTE VQVVEKPFSTELINPRKEEKQSSDSQEQLAEHK NLETKKEEKISPKEKTGVNTLNPQDEVLSGQLNK PELLYREETMETKIDFQEEIQENPDLAEGTVRVKQ EGKLGKKVEIVRIFSVNKEEVSREIVSTSTTAPSPRIV This study N/A rZmpB, expressed in E. coli YLSGDILKTLGLDTVLEETSAKPGEVTVVEVETPQ SITNQEQARTENQVVETEEAPKEEAPKTEESPKEE PKSEVKPTDDTLPKVEEGKEDSAEPAPVEEVGGE VESKPEEKVAVKPESQPSDKPAEESKVEQAGEPV APREDEKAPVEPEKQPEAPEEEKAVEETPKQEES TPDTKAEETVEPKEETVNQSIEQPKVETPAVEKQTE PTEEPKVEQAGEPVAPREDEQAPTAPVEPEKQPE VPEEEKAVEETPKPEDKIKGIGTKEPVDKSELNNQ IDKASSVSPTDYSTASYNALGPVLETAKG VYASEPVKQPEVNSET This study N/A rZmpC, expressed in E. coli GYIKTKKQDNTELSRTVDGKYSAQRDSQPNS TKTSDVVHSADLEWNQGQGKVSLQGEASGDD GLSEKSSIAADNLSSNDSFASQVEQNPDHKGES VVRPTVPEQGNPVSATTVQSAEEEVLATTNDRP EYKLPLETKGTQEPGHEGEAAVREDLPVYTKPLE TKGTQGPGHEGEAAVREEEPAYTEPLATKGTQE PGHEGKATVREETLEYTEPVATKGTQEPEH EGEAAVEEELPALEV This study N/A Todd-Hewitt Broth Fisher Cat#: 50-201-5330 Difco Yeast Extract, low-dusting (LD) Gibco Cat#: DF210933 Streptomycin Fisher Scientific Cat#: BP910 Kanamycin Sigma-Aldrich Cat#: K4000 LB Broth Fisher Cat#: BP1426-500 Bovine serum albumin (BSA) RPI Cat#: A30075–100.0 Sodium deoxycholate (10%) Fisher Cat#: S285-100 2X Laemmli Sample Buffer Bio-Rad Cat#: 1610737 Tween 20, MP Biomedicals Fisher Cat#: MP1TWEEN 201 Pierce ECL substrate solution Thermo Fisher Cat#: PI32209 Competence-stimulating Peptide-2 (CPS-2) Fisher Cat#: NC1376619 IPTG RPI Cat#: I56000–100.0 Freund’s complete adjuvant Sigma Cat#: F5881-6X10ML Freund’s incomplete adjuvant Sigma Cat#: F5506-10ML Hemoxylin (Stain Harris) CardinalHealth Cat#: S7442-22 Eosin (Stain Eosin-Y) CardinalHealth Cat#: S7442-17 Invitrogen NucBlue Fixed Cell ReadyProbes Reagent (DAPI) Fisher Cat#: R37606 Millipore Sigma FluorSave Reagent Fisher Cat#: 34-578-920ML Prigrow-III Medium Abm Cat#: TM003 Bovine Serum Albumin, Heat Shock Treated Fisher Cat#: BP1600-100 Gibco GlutaMAX Supplement Fisher Cat#: 35-050-061 Gibco Antibiotic/Antimycotic (100X) Fisher Cat#: 15-240-062 Endothelial Cell Growth Factor Corning Cat#: 356006 Claycomb media Sigma-Aldrich Cat#: NC9450441 (Continued on next page) 18 Cell Reports ▪▪, 116574, ▪▪, 2025 OPEN ACCESS

    other:

    Article Title: A triple-action PROTAC for wild-type p53 cancer therapy
    Article Snippet: BL21(DE3) E. coli , NEB , Cat# C2527H.

    Recombinant:

    Article Title: CCDC32 stabilizes clathrin-coated pits and drives their invagination
    Article Snippet: .. Strain ( E. coli ) , BL21(DE3) , NEB: C2527H , , Used for recombinant protein expression.. .. Cell line ( Homo sapiens ) , HEK293T , ATCC: CRL-3216 , RRID: CVCL_0063 , Used for lentivirus packaging..

    Expressing:

    Article Title: CCDC32 stabilizes clathrin-coated pits and drives their invagination
    Article Snippet: .. Strain ( E. coli ) , BL21(DE3) , NEB: C2527H , , Used for recombinant protein expression.. .. Cell line ( Homo sapiens ) , HEK293T , ATCC: CRL-3216 , RRID: CVCL_0063 , Used for lentivirus packaging..

    Clone Assay:

    Article Title: Myeloid PINK1 represses mtDNA release and immune signaling that impacts neuronal pathology in patient-derived idiopathic PD models
    Article Snippet: .. Adapted from the protocol by Feller et al. [ ], the human wild-type α-synuclein (α-syn) gene was cloned into a pGEX-6P-1 plasmid (University of Dundee MRC Protein Phosphorylation and Ubiquitination Unit, DU30005) and transformed to BL-21(DE3) E.coli. (New England Biolabs, C2527H). .. The protein was over-expressed as GST-tagged α-syn in the presence of the inducer IPTG and was isolated through affinity binding to Glutathione Sepharose® 4B resin (GE Healthcare, 17075601).

    Plasmid Preparation:

    Article Title: Myeloid PINK1 represses mtDNA release and immune signaling that impacts neuronal pathology in patient-derived idiopathic PD models
    Article Snippet: .. Adapted from the protocol by Feller et al. [ ], the human wild-type α-synuclein (α-syn) gene was cloned into a pGEX-6P-1 plasmid (University of Dundee MRC Protein Phosphorylation and Ubiquitination Unit, DU30005) and transformed to BL-21(DE3) E.coli. (New England Biolabs, C2527H). .. The protein was over-expressed as GST-tagged α-syn in the presence of the inducer IPTG and was isolated through affinity binding to Glutathione Sepharose® 4B resin (GE Healthcare, 17075601).

    Phospho-proteomics:

    Article Title: Myeloid PINK1 represses mtDNA release and immune signaling that impacts neuronal pathology in patient-derived idiopathic PD models
    Article Snippet: .. Adapted from the protocol by Feller et al. [ ], the human wild-type α-synuclein (α-syn) gene was cloned into a pGEX-6P-1 plasmid (University of Dundee MRC Protein Phosphorylation and Ubiquitination Unit, DU30005) and transformed to BL-21(DE3) E.coli. (New England Biolabs, C2527H). .. The protein was over-expressed as GST-tagged α-syn in the presence of the inducer IPTG and was isolated through affinity binding to Glutathione Sepharose® 4B resin (GE Healthcare, 17075601).

    Ubiquitin Proteomics:

    Article Title: Myeloid PINK1 represses mtDNA release and immune signaling that impacts neuronal pathology in patient-derived idiopathic PD models
    Article Snippet: .. Adapted from the protocol by Feller et al. [ ], the human wild-type α-synuclein (α-syn) gene was cloned into a pGEX-6P-1 plasmid (University of Dundee MRC Protein Phosphorylation and Ubiquitination Unit, DU30005) and transformed to BL-21(DE3) E.coli. (New England Biolabs, C2527H). .. The protein was over-expressed as GST-tagged α-syn in the presence of the inducer IPTG and was isolated through affinity binding to Glutathione Sepharose® 4B resin (GE Healthcare, 17075601).

    Transformation Assay:

    Article Title: Myeloid PINK1 represses mtDNA release and immune signaling that impacts neuronal pathology in patient-derived idiopathic PD models
    Article Snippet: .. Adapted from the protocol by Feller et al. [ ], the human wild-type α-synuclein (α-syn) gene was cloned into a pGEX-6P-1 plasmid (University of Dundee MRC Protein Phosphorylation and Ubiquitination Unit, DU30005) and transformed to BL-21(DE3) E.coli. (New England Biolabs, C2527H). .. The protein was over-expressed as GST-tagged α-syn in the presence of the inducer IPTG and was isolated through affinity binding to Glutathione Sepharose® 4B resin (GE Healthcare, 17075601).



    Similar Products

    c2527h  (New England Biolabs)
    99
    New England Biolabs c2527h
    C2527h, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pmc13049519-2-9-5
    Average 99 stars, based on 1 article reviews
    c2527h - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    competent cells neb c2527h lysogeny broth lb formedium lb0102 terrific broth tb  (Formedium)
    86
    Formedium competent cells neb c2527h lysogeny broth lb formedium lb0102 terrific broth tb
    Competent Cells Neb C2527h Lysogeny Broth Lb Formedium Lb0102 Terrific Broth Tb, supplied by Formedium, used in various techniques. Bioz Stars score: 86/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/broth+terrific/pm42097140-187-30-37
    Average 86 stars, based on 1 article reviews
    competent cells neb c2527h lysogeny broth lb formedium lb0102 terrific broth tb - by Bioz Stars, 2026-10
    86/100 stars
    		  Buy from Supplier
    e coli bl21 de3 competent cells  (New England Biolabs)
    99
    New England Biolabs e coli bl21 de3 competent cells
    E Coli Bl21 De3 Competent Cells, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pm42047214-247-5-11
    Average 99 stars, based on 1 article reviews
    e coli bl21 de3 competent cells - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    competent bl21 de3 e coli  (New England Biolabs)
    99
    New England Biolabs competent bl21 de3 e coli
    Competent Bl21 De3 E Coli, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/10__1002_slash_cmtd__70098-243-28-32
    Average 99 stars, based on 1 article reviews
    competent bl21 de3 e coli - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    e coli bl21 de3 cells  (New England Biolabs)
    99
    New England Biolabs e coli bl21 de3 cells
    E Coli Bl21 De3 Cells, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pm42017951-394-30-35
    Average 99 stars, based on 1 article reviews
    e coli bl21 de3 cells - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    e coli bl21 strain  (New England Biolabs)
    99
    New England Biolabs e coli bl21 strain
    FRET constructs and ratio (A) Plasmid designs of various constructs are illustrated. The sequences of three linkers and two tandem repeats (TR) proteins used in the study are shown. (B) Representative image of E. coli cultures expressing each construct. (C) Scatterplot of fluorescence intensity obtained in the green and red channels with the plate reader. The dotted and solid circles denote two biological replicates per sample with eight technical replicates each. FRET ratios measured by HyCAP are significantly higher than those determined by the plate reader, owing to differences in the excitation and emission measurement setups. FRET ratio distributions of replicates measured using plate reader (30 replicates each) (D) and HyCAP (E).
    E Coli Bl21 Strain, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pmc13049519-2-0-5
    Average 99 stars, based on 1 article reviews
    e coli bl21 strain - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    competent e coli bl21 de3 cells  (New England Biolabs)
    99
    New England Biolabs competent e coli bl21 de3 cells
    FRET constructs and ratio (A) Plasmid designs of various constructs are illustrated. The sequences of three linkers and two tandem repeats (TR) proteins used in the study are shown. (B) Representative image of E. coli cultures expressing each construct. (C) Scatterplot of fluorescence intensity obtained in the green and red channels with the plate reader. The dotted and solid circles denote two biological replicates per sample with eight technical replicates each. FRET ratios measured by HyCAP are significantly higher than those determined by the plate reader, owing to differences in the excitation and emission measurement setups. FRET ratio distributions of replicates measured using plate reader (30 replicates each) (D) and HyCAP (E).
    Competent E Coli Bl21 De3 Cells, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pm41986695-208-0-5
    Average 99 stars, based on 1 article reviews
    competent e coli bl21 de3 cells - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier
    e 21 coli bl21 de3 cells  (New England Biolabs)
    99
    New England Biolabs e 21 coli bl21 de3 cells
    FRET constructs and ratio (A) Plasmid designs of various constructs are illustrated. The sequences of three linkers and two tandem repeats (TR) proteins used in the study are shown. (B) Representative image of E. coli cultures expressing each construct. (C) Scatterplot of fluorescence intensity obtained in the green and red channels with the plate reader. The dotted and solid circles denote two biological replicates per sample with eight technical replicates each. FRET ratios measured by HyCAP are significantly higher than those determined by the plate reader, owing to differences in the excitation and emission measurement setups. FRET ratio distributions of replicates measured using plate reader (30 replicates each) (D) and HyCAP (E).
    E 21 Coli Bl21 De3 Cells, supplied by New England Biolabs, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
    https://www.bioz.com/product/c2527h/BL21+(DE3)+Competent+E%2E+coli/pm41991054-87-14-20
    Average 99 stars, based on 1 article reviews
    e 21 coli bl21 de3 cells - by Bioz Stars, 2026-10
    99/100 stars
    		  Buy from Supplier

    Image Search Results


    FRET constructs and ratio (A) Plasmid designs of various constructs are illustrated. The sequences of three linkers and two tandem repeats (TR) proteins used in the study are shown. (B) Representative image of E. coli cultures expressing each construct. (C) Scatterplot of fluorescence intensity obtained in the green and red channels with the plate reader. The dotted and solid circles denote two biological replicates per sample with eight technical replicates each. FRET ratios measured by HyCAP are significantly higher than those determined by the plate reader, owing to differences in the excitation and emission measurement setups. FRET ratio distributions of replicates measured using plate reader (30 replicates each) (D) and HyCAP (E).

    Journal: iScience

    Article Title: High-throughput screening of FRET-based proteins using a hyperspectral microcapillary array

    doi: 10.1016/j.isci.2026.115302

    Figure Lengend Snippet: FRET constructs and ratio (A) Plasmid designs of various constructs are illustrated. The sequences of three linkers and two tandem repeats (TR) proteins used in the study are shown. (B) Representative image of E. coli cultures expressing each construct. (C) Scatterplot of fluorescence intensity obtained in the green and red channels with the plate reader. The dotted and solid circles denote two biological replicates per sample with eight technical replicates each. FRET ratios measured by HyCAP are significantly higher than those determined by the plate reader, owing to differences in the excitation and emission measurement setups. FRET ratio distributions of replicates measured using plate reader (30 replicates each) (D) and HyCAP (E).

    Article Snippet: E. coli BL21 strain , New England Biolabs , C2527H.

    Techniques: Construct, Plasmid Preparation, Expressing, Fluorescence